PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_011810-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family B3
Protein Properties Length: 436aa    MW: 49621.6 Da    PI: 10.0114
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_011810-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B355.21.3e-171751797
                   E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
             B3 17 vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97
                   v+p kf+++ +++   s  +tl+ ++g++W+v l   k +++ +++ GW eFv++++L+e D +vF+++g+s+f   v +f
  NNU_011810-RA  1 VIPAKFVKNLKED--LSSPVTLRGPTGKVWKVGL--VKAGDSLFFQYGWDEFVEDHNLEEEDLLVFRYSGSSTF--DVLMF 75
                   79*****666655..6667***************..9********************************98888..66665 PP

2B342.21.4e-13249339194
                    EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
             B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                    f+ v+ + +v ++  l++p   ++ +  + ++++++t  +++g++W v ++y+ ++    +++GW +Fv +n+L+e D++vF+++g ++ + +v
  NNU_011810-RA 249 FIVVMRQTHVCRRFHLTIPVLDVTYNF-P-PRNQDVT-LSLKGKTWPVIFKYQTNPLNGGFASGWADFVFDNNLEEDDVCVFEVVGGRNNSILV 339
                    778899999999*99********6665.3.3555787.6789**********888888889**********************88654443333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd100179.79E-17176No hitNo description
SMARTSM010198.3E-6178IPR003340B3 DNA binding domain
PfamPF023622.7E-14172IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.106.9E-21176IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086316.088178IPR003340B3 DNA binding domain
SuperFamilySSF1019363.73E-20176IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.1E-17241345IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.47E-18244345IPR015300DNA-binding pseudobarrel domain
CDDcd100173.57E-17247345No hitNo description
SMARTSM010194.9E-11249347IPR003340B3 DNA binding domain
PfamPF023628.7E-12249344IPR003340B3 DNA binding domain
PROSITE profilePS5086311.73249347IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 436 aa     Download sequence    Send to blast
VIPAKFVKNL KEDLSSPVTL RGPTGKVWKV GLVKAGDSLF FQYGWDEFVE DHNLEEEDLL  60
VFRYSGSSTF DVLMFDQLNL CEKECSYFVG KCGCERKENT RDDSMEADFM HSSVERGRRG  120
GRRRRFTSST KTNQGRRGRG RGRGRRTFIS PTNEEELKTS EPGIRRNSSQ SNDRSVRKEA  180
SASVRDCAKR KFMGEESADS FGDDGIPENL SRSYQLHFVS KRRPVTEVEK KRAYQLASAA  240
SASTDHRSFI VVMRQTHVCR RFHLTIPVLD VTYNFPPRNQ DVTLSLKGKT WPVIFKYQTN  300
PLNGGFASGW ADFVFDNNLE EDDVCVFEVV GGRNNSILVN VQIFRVVEAV TPLRKVKCPS  360
RRSAKRQVKE ALDKILCRDR IKLWVVLITD GKDLNKASSL LLFVLLLGCR NFISHNILSL  420
VFSNHVLHPA VIKVHV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010263796.10.0PREDICTED: B3 domain-containing protein REM16-like
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.12e-30B3 family protein